DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG16713 and Wfdc8

DIOPT Version :9

Sequence 1:	NP_608799.1	Gene:	CG16713 / 33591	FlyBaseID:	FBgn0031560	Length:	82	Species:	Drosophila melanogaster
Sequence 2:	NP_001292357.1	Gene:	Wfdc8 / 685170	RGDID:	1597713	Length:	237	Species:	Rattus norvegicus

Alignment Length:	57	Identity:	19/57 - (33%)
Similarity:	31/57 - (54%)	Gaps:	5/57 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    25 CGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCL 81
            |.||....     :|:..:..|.:|:.:::|..|.|.|||||:|.|.|:..|.:.|:
  Rat    91 CLLPSDAG-----NCKDTLTHWYFDSQKHKCRAFTYSGCGGNSNNFLSKADCRNACM 142

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG16713	NP_608799.1	KU	23..81	CDD:238057	18/55 (33%)
Wfdc8	NP_001292357.1	WAP	45..86	CDD:278522
		Kunitz_BPTI	90..142	CDD:278443	18/55 (33%)
		WAP	<145..186	CDD:294103
		WAP	195..235	CDD:278522
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000145
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X776
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	4	3.810