DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Wfdc6a

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001233212.2 Gene:Wfdc6a / 685153 RGDID:1597730 Length:146 Species:Rattus norvegicus


Alignment Length:61 Identity:27/61 - (44%)
Similarity:31/61 - (50%) Gaps:5/61 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            |:..||.||....     .|.||:|.|.|:.|...|.:||||||.||.|.|.|..||...|
  Rat    82 LREDICSLPQDAG-----PCLAYLPRWWYNEDTGLCTQFIYGGCQGNPNNFQSEGICTVVC 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 25/55 (45%)
Wfdc6aNP_001233212.2 WAP 42..81 CDD:459672
Kunitz_eppin 85..141 CDD:438654 26/58 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.