| Sequence 1: | NP_608799.1 | Gene: | CG16713 / 33591 | FlyBaseID: | FBgn0031560 | Length: | 82 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001233212.2 | Gene: | Wfdc6a / 685153 | RGDID: | 1597730 | Length: | 146 | Species: | Rattus norvegicus |
| Alignment Length: | 61 | Identity: | 27/61 - (44%) |
|---|---|---|---|
| Similarity: | 31/61 - (50%) | Gaps: | 5/61 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 20 LKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG16713 | NP_608799.1 | Kunitz_SCI-I-like | 24..80 | CDD:438677 | 25/55 (45%) |
| Wfdc6a | NP_001233212.2 | WAP | 42..81 | CDD:459672 | |
| Kunitz_eppin | 85..141 | CDD:438654 | 26/58 (45%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||