powered by:
Protein Alignment CG16713 and Wfdc6a
DIOPT Version :9
Sequence 1: | NP_608799.1 |
Gene: | CG16713 / 33591 |
FlyBaseID: | FBgn0031560 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001233212.2 |
Gene: | Wfdc6a / 685153 |
RGDID: | 1597730 |
Length: | 146 |
Species: | Rattus norvegicus |
Alignment Length: | 61 |
Identity: | 27/61 - (44%) |
Similarity: | 31/61 - (50%) |
Gaps: | 5/61 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 LKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
|:..||.||.... .|.||:|.|.|:.|...|.:||||||.||.|.|.|..||...|
Rat 82 LREDICSLPQDAG-----PCLAYLPRWWYNEDTGLCTQFIYGGCQGNPNNFQSEGICTVVC 137
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG16713 | NP_608799.1 |
KU |
23..81 |
CDD:238057 |
26/58 (45%) |
Wfdc6a | NP_001233212.2 |
WAP |
42..81 |
CDD:278522 |
|
Kunitz_BPTI |
86..138 |
CDD:278443 |
26/57 (46%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
5 | 4.810 |
|
Return to query results.
Submit another query.