powered by:
Protein Alignment CG16713 and Spint3
DIOPT Version :9
Sequence 1: | NP_608799.1 |
Gene: | CG16713 / 33591 |
FlyBaseID: | FBgn0031560 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_006235690.1 |
Gene: | Spint3 / 685136 |
RGDID: | 1597746 |
Length: | 87 |
Species: | Rattus norvegicus |
Alignment Length: | 58 |
Identity: | 23/58 - (39%) |
Similarity: | 28/58 - (48%) |
Gaps: | 5/58 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 AICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
::|.||.. .|: |.|....|.||....:|..|.||||.||.|.|.||..|:..|
Rat 32 SMCTLPME-KGE----CRAIFVRWYYDTKTKKCDWFHYGGCRGNENNFLSRNQCQTVC 84
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG16713 | NP_608799.1 |
KU |
23..81 |
CDD:238057 |
23/58 (40%) |
Spint3 | XP_006235690.1 |
KU |
34..84 |
CDD:238057 |
22/54 (41%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
56 |
1.000 |
Inparanoid score |
I5336 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.960 |
|
Return to query results.
Submit another query.