DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and SPINT1

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_857593.1 Gene:SPINT1 / 6692 HGNCID:11246 Length:529 Species:Homo sapiens


Alignment Length:42 Identity:17/42 - (40%)
Similarity:22/42 - (52%) Gaps:0/42 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            |:..||.|.|:.....|.:|.||||.||.|.|...:.|.:.|
Human   400 CKESIPRWYYNPFSEHCARFTYGGCYGNKNNFEEEQQCLESC 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 16/40 (40%)
SPINT1NP_857593.1 MANEC 50..139 CDD:462186
Kunitz_HAI1_1-like 245..303 CDD:438666
LDLa 334..366 CDD:197566
Kunitz_HAI1_2-like 390..450 CDD:438667 17/42 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.