powered by:
Protein Alignment CG16713 and wfikkn2a
DIOPT Version :9
Sequence 1: | NP_608799.1 |
Gene: | CG16713 / 33591 |
FlyBaseID: | FBgn0031560 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_693394.5 |
Gene: | wfikkn2a / 564992 |
ZFINID: | ZDB-GENE-120914-1 |
Length: | 573 |
Species: | Danio rerio |
Alignment Length: | 58 |
Identity: | 28/58 - (48%) |
Similarity: | 35/58 - (60%) |
Gaps: | 5/58 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 AICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
|.|.|| |:.| .|:||.|.|:|.....:|..|:|||||||.|.|.|:|.||:.|
Zfish 381 APCSLP-SVQG----PCKAYKPRWAYSHALKKCQSFVYGGCGGNENNFESKEACEEMC 433
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5594 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.940 |
|
Return to query results.
Submit another query.