DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and spint2

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001070718.2 Gene:spint2 / 562009 ZFINID:ZDB-GENE-061013-323 Length:431 Species:Danio rerio


Alignment Length:57 Identity:24/57 - (42%)
Similarity:29/57 - (50%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCL 81
            |..|.::.     :|.|..|.:.||.....|..|||||||||.|.|.|:..||..||
Zfish   133 CRFPSAVG-----NCRAAFPRFFYDITDQTCKSFIYGGCGGNENNFYSQAECEASCL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 22/54 (41%)
spint2NP_001070718.2 MANEC <56..108 CDD:471454
Kunitz-type 133..183 CDD:438633 22/54 (41%)
Kunitz-type 228..276 CDD:438633
Kunitz-type 302..354 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.