DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG16713 and tfpi2

DIOPT Version :9

Sequence 1:	NP_608799.1	Gene:	CG16713 / 33591	FlyBaseID:	FBgn0031560	Length:	82	Species:	Drosophila melanogaster
Sequence 2:	NP_001035185.1	Gene:	tfpi2 / 560339	ZFINID:	ZDB-GENE-060503-38	Length:	233	Species:	Danio rerio

Alignment Length:	46	Identity:	21/46 - (45%)
Similarity:	29/46 - (63%)	Gaps:	2/46 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly    35 GRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            ||  |.|.||.:.|::....|.:|:|.||||:||.|.|::.|.|.|
Zfish   157 GR--CSASIPRYYYNSATKTCEEFMYTGCGGSNNNFISKQSCVDVC 200

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG16713	NP_608799.1	KU	23..81	CDD:238057	21/46 (46%)
tfpi2	NP_001035185.1	KU	28..80	CDD:197529
		Kunitz_BPTI	89..141	CDD:278443
		Kunitz_BPTI	149..201	CDD:278443	21/46 (46%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000145
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	3	2.810