DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and col28a1a

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001334976.1 Gene:col28a1a / 555428 ZFINID:ZDB-GENE-070705-84 Length:1170 Species:Danio rerio


Alignment Length:64 Identity:26/64 - (40%)
Similarity:34/64 - (53%) Gaps:5/64 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ALKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCLQ 82
            :||:..||     .|.....|..|...|.||...|.|.:|.||||.||:|||.:.:||:..|:|
Zfish  1111 SLKHVGCG-----QGLDPGPCREYSVMWYYDPQANACAQFWYGGCQGNSNRFETEDICKSTCVQ 1169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 22/55 (40%)
col28a1aNP_001334976.1 vWFA_subfamily_ECM 49..214 CDD:238727
gly_rich_SclB <246..>551 CDD:468478
gly_rich_SclB <482..>766 CDD:468478
VWA 802..980 CDD:459670
Kunitz_collagen_alpha1_XXVIII 1117..1167 CDD:438671 22/54 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.