DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Wfdc6b

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:XP_006499938.1 Gene:Wfdc6b / 433502 MGIID:3575430 Length:155 Species:Mus musculus


Alignment Length:64 Identity:27/64 - (42%)
Similarity:34/64 - (53%) Gaps:5/64 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LALKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCL 81
            |.|...||.||....     .|.||:|.|.|:.|...|::||||||.||.|.|.|:.:|...|:
Mouse    88 LDLSEDICSLPQDAG-----PCLAYLPRWWYNQDTKLCIEFIYGGCQGNPNNFESKAVCTSICI 146

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 24/55 (44%)