DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and CG17380

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_651145.2 Gene:CG17380 / 42766 FlyBaseID:FBgn0039077 Length:119 Species:Drosophila melanogaster


Alignment Length:76 Identity:27/76 - (35%)
Similarity:40/76 - (52%) Gaps:5/76 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGG 65
            |..|....:|:.....:.||::..|..   :...|  .|:.....::||.|.|.||:||||||||
  Fly     1 MNSLHYFLIFLIVPGTSTALRHERCSF---IANPG--PCKGNFEMFAYDMDNNVCVEFIYGGCGG 60

  Fly    66 NNNRFNSREIC 76
            |.|||.:::.|
  Fly    61 NPNRFQTKKEC 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 22/53 (42%)
CG17380NP_651145.2 Kunitz-type 25..75 CDD:438633 22/52 (42%)

Return to query results.
Submit another query.