DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and CG34276

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001097810.1 Gene:CG34276 / 41934 FlyBaseID:FBgn0085305 Length:91 Species:Drosophila melanogaster


Alignment Length:80 Identity:23/80 - (28%)
Similarity:40/80 - (50%) Gaps:6/80 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLLILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGN 66
            |:..|:.:.|..:..:.::|.. |..|..: |.|:    ||:.:|.|::....|.:||:.|...|
  Fly     4 KISCLLILLVFCLQQSYSIKRR-CLQPLDV-GKGK----AYLRNWFYNSTSQRCQRFIFYGGASN 62

  Fly    67 NNRFNSREICEDKCL 81
            .|.||::..|...||
  Fly    63 GNNFNTQARCHKICL 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 17/55 (31%)
CG34276NP_001097810.1 Kunitz_ixolaris_2 26..76 CDD:438669 17/54 (31%)

Return to query results.
Submit another query.