powered by:
Protein Alignment CG16713 and Spint5p
DIOPT Version :9
Sequence 1: | NP_608799.1 |
Gene: | CG16713 / 33591 |
FlyBaseID: | FBgn0031560 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001008881.1 |
Gene: | Spint5p / 408232 |
RGDID: | 1302989 |
Length: | 167 |
Species: | Rattus norvegicus |
Alignment Length: | 66 |
Identity: | 19/66 - (28%) |
Similarity: | 31/66 - (46%) |
Gaps: | 9/66 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 GLPHSLNGDGRISCEAYIPS---------WSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCL 81
|:.:.|...|.:.|...:.. :.::.|...|..||:.|||||.|.|.|:.:||..|:
Rat 55 GVRNQLCESGHLGCNQPVKKGHCTFRFYRYYFNKDTALCELFIFSGCGGNRNNFKSKYLCELHCI 119
Fly 82 Q 82
:
Rat 120 E 120
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG16713 | NP_608799.1 |
KU |
23..81 |
CDD:238057 |
18/63 (29%) |
Spint5p | NP_001008881.1 |
KU |
68..118 |
CDD:197529 |
15/49 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X776 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.810 |
|
Return to query results.
Submit another query.