DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Spint5p

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001008881.1 Gene:Spint5p / 408232 RGDID:1302989 Length:167 Species:Rattus norvegicus


Alignment Length:66 Identity:19/66 - (28%)
Similarity:31/66 - (46%) Gaps:9/66 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GLPHSLNGDGRISCEAYIPS---------WSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCL 81
            |:.:.|...|.:.|...:..         :.::.|...|..||:.|||||.|.|.|:.:||..|:
  Rat    55 GVRNQLCESGHLGCNQPVKKGHCTFRFYRYYFNKDTALCELFIFSGCGGNRNNFKSKYLCELHCI 119

  Fly    82 Q 82
            :
  Rat   120 E 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 18/63 (29%)
Spint5pNP_001008881.1 KU 68..118 CDD:197529 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X776
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.