DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Wfdc6b

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001008867.1 Gene:Wfdc6b / 408225 RGDID:1303277 Length:182 Species:Rattus norvegicus


Alignment Length:63 Identity:28/63 - (44%)
Similarity:33/63 - (52%) Gaps:5/63 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LALKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            |.|...||.||....     .|.||:|.|.|:...|.|.:||||||.||.|.|.|::||...|
  Rat    70 LDLNEDICSLPQDAG-----PCLAYLPRWWYNKKTNLCTQFIYGGCQGNTNNFLSKDICTSIC 127

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 26/58 (45%)