DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Wfikkn1

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001123248.1 Gene:Wfikkn1 / 363555 RGDID:1565835 Length:552 Species:Rattus norvegicus


Alignment Length:57 Identity:25/57 - (43%)
Similarity:32/57 - (56%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            :|.|| .:.|    .|:.:.|.|:|.....:|..|||.||.||:|.|.|||.|||.|
  Rat   362 VCALP-PVQG----PCQGWEPRWAYSPLLQQCHPFIYSGCEGNSNNFESRESCEDAC 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 25/57 (44%)
Wfikkn1NP_001123248.1 WAP 34..80 CDD:278522
KAZAL_FS 124..159 CDD:238052
I-set 196..284 CDD:254352
Ig_3 204..284 CDD:143242
KU 311..356 CDD:294074
KU 361..413 CDD:197529 24/55 (44%)
NTR_like 431..541 CDD:295338
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.