DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and CG2816

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster


Alignment Length:78 Identity:26/78 - (33%)
Similarity:45/78 - (57%) Gaps:5/78 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNN 67
            ||:.:.:.:...:.|.:.:..:| |...::|    .|..|:.|::|:..:..|..|||||||||:
  Fly     9 LLVGLLLLIPHHSGAASKRVKLC-LQPMISG----RCFGYVESYAYNPIKRHCEPFIYGGCGGND 68

  Fly    68 NRFNSREICEDKC 80
            |||:::..||..|
  Fly    69 NRFSTKAECEFNC 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 22/55 (40%)
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 22/55 (40%)

Return to query results.
Submit another query.