DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and IM33

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001285594.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster


Alignment Length:80 Identity:45/80 - (56%)
Similarity:57/80 - (71%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGG 65
            ||.:..|.:..|.||.||.||:.|||||..::|:|.|.|.|:|||:||..:.|.|.|||||||||
  Fly     1 MKFIAAVCLMFALVAVALGLKDPICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGG 65

  Fly    66 NNNRFNSREICEDKC 80
            |.|||.::|:||.||
  Fly    66 NENRFGTQELCEQKC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 35/58 (60%)
IM33NP_001285594.1 KU 23..81 CDD:238057 35/58 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9953
eggNOG 1 0.900 - - E1_KOG4295
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5463
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 1 1.000 - - mtm8563
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X776
76.860

Return to query results.
Submit another query.