DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and CG3513

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_608798.1 Gene:CG3513 / 33590 FlyBaseID:FBgn0031559 Length:88 Species:Drosophila melanogaster


Alignment Length:85 Identity:34/85 - (40%)
Similarity:51/85 - (60%) Gaps:15/85 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FVAFVANALAL-----------KNAICGLPHSLNG---DGRISCEAYIPSWSYDADRNECVKFIY 60
            ::.|||.|..|           |..:|..|.|:.|   || .:|.|::|:|:|||.:|.|.:||:
  Fly     3 YIGFVAIAFLLSLSGSRLWVHAKPEMCQQPSSMVGMAQDG-AACMAFMPAWTYDASKNACTEFIF 66

  Fly    61 GGCGGNNNRFNSREICEDKC 80
            ||||||:|:|:::..||..|
  Fly    67 GGCGGNSNQFSTKSECEKAC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 28/61 (46%)
CG3513NP_608798.1 KU 29..87 CDD:238057 28/59 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5463
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X776
54.860

Return to query results.
Submit another query.