DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and CG16704

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001285593.1 Gene:CG16704 / 33589 FlyBaseID:FBgn0031558 Length:79 Species:Drosophila melanogaster


Alignment Length:81 Identity:35/81 - (43%)
Similarity:46/81 - (56%) Gaps:5/81 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLILVFVFVAFVANALA-LKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCG 64
            ||.|::..:....||:|.| |||.|||....:.|    :|.:..|.|:|..|.|||..|.|.||.
  Fly     1 MKYLVVFALICCLVASAFATLKNPICGEEFGVKG----TCRSLQPMWTYRPDTNECFTFNYSGCH 61

  Fly    65 GNNNRFNSREICEDKC 80
            ||||.|:.:..||:||
  Fly    62 GNNNLFHKKLECEEKC 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 25/58 (43%)
CG16704NP_001285593.1 KU 34..78 CDD:294074 22/48 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5463
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.