DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and LOC3292058

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:XP_553610.4 Gene:LOC3292058 / 3292058 VectorBaseID:AGAMI1_012805 Length:155 Species:Anopheles gambiae


Alignment Length:56 Identity:22/56 - (39%)
Similarity:30/56 - (53%) Gaps:5/56 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            |.||     ..|..|.|.:|.:.||..:.||::|.:|||.||.|.|.|.:.|.:.|
Mosquito   102 CKLP-----PRRGVCRALLPRFRYDPAQKECIEFKFGGCDGNANNFMSYKQCMEAC 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 21/54 (39%)
LOC3292058XP_553610.4 None

Return to query results.
Submit another query.