DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and CG31609

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_723444.2 Gene:CG31609 / 318845 FlyBaseID:FBgn0051609 Length:123 Species:Drosophila melanogaster


Alignment Length:77 Identity:27/77 - (35%)
Similarity:38/77 - (49%) Gaps:5/77 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNN 68
            |:.::..||.|.....:|...|..   :...|  .|:.::..|.||...|.|:.|.|||||||.|
  Fly    10 LLFLYPVVAVVPQGFTIKQPKCWY---VANPG--PCDDFVKVWGYDYLTNRCIFFYYGGCGGNPN 69

  Fly    69 RFNSREICEDKC 80
            ||.::|.|...|
  Fly    70 RFYTKEECLKTC 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 21/55 (38%)
CG31609NP_723444.2 Kunitz-type 31..81 CDD:444694 21/54 (39%)

Return to query results.
Submit another query.