DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Spint2

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001076018.1 Gene:Spint2 / 292770 RGDID:735123 Length:250 Species:Rattus norvegicus


Alignment Length:89 Identity:28/89 - (31%)
Similarity:35/89 - (39%) Gaps:29/89 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KNAICGLPHSLNGDGRIS-----------------------------CEAYIPSWSYDADRNECV 56
            :|.|.||..|.:|...:|                             |.|..|.|.||.::|.|.
  Rat    93 ENTIDGLARSSDGASALSVPRKQDSADLAGEIFNYEEYCVPKAVTGPCRAAFPRWYYDVEKNSCS 157

  Fly    57 KFIYGGCGGNNNRFNSREICEDKC 80
            .||||||.||.|.:.|:|.|...|
  Rat   158 SFIYGGCRGNKNSYLSQEACMQHC 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 26/84 (31%)
Spint2NP_001076018.1 Kunitz_HAI2_1-like 36..88 CDD:438664
Kunitz_HAI2_2-like 129..181 CDD:438665 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.