DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Wfikkn2

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:XP_220855.1 Gene:Wfikkn2 / 287631 RGDID:1305361 Length:571 Species:Rattus norvegicus


Alignment Length:74 Identity:32/74 - (43%)
Similarity:42/74 - (56%) Gaps:8/74 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FVAFVANALALKN---AICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFN 71
            |..:.|..||..:   |.|.|| :|.|    .|:||:|.|:|::....|..|:||||.||.|.|.
  Rat   363 FETYEACMLACMSGPLATCSLP-ALQG----PCKAYVPRWAYNSQTGLCQSFVYGGCEGNGNNFE 422

  Fly    72 SREICEDKC 80
            |||.||:.|
  Rat   423 SREACEESC 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 28/58 (48%)
Wfikkn2XP_220855.1 WAP 37..86 CDD:395047
KAZAL_FS 133..169 CDD:238052
IgI_3_WFIKKN-like 205..299 CDD:409422
Ig strand B 222..226 CDD:409422
Ig strand C 235..239 CDD:409422
Ig strand E 257..261 CDD:409422
Ig strand F 279..284 CDD:409422
Ig strand G 292..295 CDD:409422
Kunitz_BPTI 323..374 CDD:394972 4/10 (40%)
Kunitz_BPTI 380..431 CDD:394972 26/55 (47%)
NTR_WFIKKN 450..558 CDD:239630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.