DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Wfikkn2

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:XP_006533560.1 Gene:Wfikkn2 / 278507 MGIID:2669209 Length:585 Species:Mus musculus


Alignment Length:74 Identity:33/74 - (44%)
Similarity:43/74 - (58%) Gaps:8/74 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FVAFVANALALKN---AICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFN 71
            |..:.|..||..:   |||.|| :|.|    .|:||:|.|:|::....|..|:||||.||.|.|.
Mouse   377 FETYEACMLACMSGPLAICSLP-ALQG----PCKAYVPRWAYNSQTGLCQSFVYGGCEGNGNNFE 436

  Fly    72 SREICEDKC 80
            |||.||:.|
Mouse   437 SREACEESC 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 29/58 (50%)
Wfikkn2XP_006533560.1 WAP 51..100 CDD:365870
KAZAL_FS 147..183 CDD:238052
Ig_3 233..313 CDD:143242
KU 337..388 CDD:238057 4/10 (40%)
Kunitz_BPTI 394..445 CDD:333766 27/55 (49%)
NTR_WFIKKN 464..572 CDD:239630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5594
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.