DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and AMBP

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001624.1 Gene:AMBP / 259 HGNCID:453 Length:352 Species:Homo sapiens


Alignment Length:58 Identity:25/58 - (43%)
Similarity:33/58 - (56%) Gaps:5/58 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            |.|.||..     |..|.|:|..|::||.:.:||.|.||||.||.|:|.|.:.|.:.|
Human   285 AACNLPIV-----RGPCRAFIQLWAFDAVKGKCVLFPYGGCQGNGNKFYSEKECREYC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 23/55 (42%)
AMBPNP_001624.1 lipocalin_A1M-like 28..190 CDD:381193
Glycopeptide (secretory piece) 206..226
Kunitz_bikunin_1-like 229..282 CDD:438639
Kunitz_bikunin_2-like 284..338 CDD:438640 25/58 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.