DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Ambp

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001416262.1 Gene:Ambp / 25377 RGDID:2102 Length:361 Species:Rattus norvegicus


Alignment Length:58 Identity:24/58 - (41%)
Similarity:36/58 - (62%) Gaps:5/58 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            |.|.|| .:.|    .|.|:...|::||.:.:|::||||||.||.|:|.|.:.|::.|
  Rat   284 AACNLP-IVQG----PCRAFAELWAFDAAQGKCIQFIYGGCKGNGNKFYSEKECKEYC 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 22/55 (40%)
AmbpNP_001416262.1 None

Return to query results.
Submit another query.