DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Tfpi2

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001368837.1 Gene:Tfpi2 / 21789 MGIID:108543 Length:266 Species:Mus musculus


Alignment Length:57 Identity:25/57 - (43%)
Similarity:34/57 - (59%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            ||.||....     .|:|.||.:.||.|:.:|.:|.||||.||.|.|:||::|:..|
Mouse    71 ICLLPLDAG-----PCQALIPKFYYDRDQQKCRRFNYGGCLGNANNFHSRDLCQQTC 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 24/55 (44%)
Tfpi2NP_001368837.1 Kunitz_TFPI2_1-like 68..124 CDD:438659 25/57 (44%)
Kunitz-type 129..182 CDD:444694
Kunitz_TFPI1_TFPI2_3-like 189..242 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.