DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Tfpi

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_035706.1 Gene:Tfpi / 21788 MGIID:1095418 Length:306 Species:Mus musculus


Alignment Length:48 Identity:21/48 - (43%)
Similarity:32/48 - (66%) Gaps:2/48 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCL 81
            ||  .|:|.|.|:.::...::|.:||||||.||.|||::.|.|:..|:
Mouse    56 DG--PCKAMIRSYFFNMYTHQCEEFIYGGCEGNENRFDTLEECKKTCI 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 20/45 (44%)
TfpiNP_035706.1 Kunitz_TFPI1_1-like 47..101 CDD:438656 20/46 (43%)
Kunitz_TFPI1_2-like 117..172 CDD:438657
Kunitz_TFPI1_TFPI2_3-like 223..275 CDD:438658
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.