DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Spint2

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_035594.1 Gene:Spint2 / 20733 MGIID:1338031 Length:252 Species:Mus musculus


Alignment Length:54 Identity:23/54 - (42%)
Similarity:31/54 - (57%) Gaps:4/54 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            :|.::.|    .|.|..|.|.||.::|.|:.||||||.||.|.:.|:|.|...|
Mouse   134 VPKAVTG----PCRAAFPRWYYDTEKNSCISFIYGGCRGNKNSYLSQEACMQHC 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 22/52 (42%)
Spint2NP_035594.1 Kunitz_HAI2_1-like 36..88 CDD:438664
Kunitz_HAI2_2-like 131..183 CDD:438665 22/52 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.