DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and ZK287.4

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001256133.1 Gene:ZK287.4 / 191282 WormBaseID:WBGene00013965 Length:1285 Species:Caenorhabditis elegans


Alignment Length:58 Identity:21/58 - (36%)
Similarity:32/58 - (55%) Gaps:5/58 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCLQ 82
            |.||.:: |:|..:    ||.:.:|....:|.:|.|.|..||:|||..:..||..||:
 Worm   318 CELPPAI-GNGPFN----IPRYYFDRVTKKCERFFYSGRDGNDNRFYKKNKCERLCLR 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 19/55 (35%)
ZK287.4NP_001256133.1 Lustrin_cystein 45..91 CDD:291299
KU 98..151 CDD:238057
Kunitz_BPTI 256..309 CDD:278443
KU 318..369 CDD:238057 19/55 (35%)
Kunitz_BPTI 845..897 CDD:278443
Kunitz_BPTI 995..1044 CDD:278443
KU 1054..1105 CDD:238057
Lustrin_cystein 1148..1189 CDD:291299
KU <1215..1259 CDD:197529
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.