DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and ZC504.1

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001362150.1 Gene:ZC504.1 / 191192 WormBaseID:WBGene00013916 Length:542 Species:Caenorhabditis elegans


Alignment Length:63 Identity:18/63 - (28%)
Similarity:30/63 - (47%) Gaps:5/63 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LKNAICGLPHSLNGDGRISC-EAYIPSWSYDADRNECVKFIYGGC-GGNNNRFNSREICEDKC 80
            ::.:||.:|.:   .|...| |.....:.:|:...:|.||....| |.|.|:|.:.|:|...|
 Worm    76 MRESICSMPPN---PGYGDCFEEPRTMFYFDSLDLKCKKFKVINCFGKNQNQFETYELCTRFC 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 17/57 (30%)
ZC504.1NP_001362150.1 KU 79..135 CDD:197529 17/58 (29%)

Return to query results.
Submit another query.