DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and ZC84.1

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_499036.3 Gene:ZC84.1 / 191073 WormBaseID:WBGene00013846 Length:1561 Species:Caenorhabditis elegans


Alignment Length:52 Identity:21/52 - (40%)
Similarity:26/52 - (50%) Gaps:1/52 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SLNGDGRISCEAYIP-SWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            |||.|..|.|.|... .:.|:.....|..|.|.||.||:|.|.:|:.||..|
 Worm   636 SLNTDSGIQCGAGSTFKYYYNPQTQNCESFQYNGCDGNSNNFANRDACESYC 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 21/52 (40%)
ZC84.1NP_499036.3 EB 132..185 CDD:279949
Kunitz_BPTI 308..364 CDD:278443
KU <447..484 CDD:197529
Kunitz_BPTI 530..582 CDD:278443
Kunitz_BPTI 634..687 CDD:278443 20/50 (40%)
Kunitz_BPTI 743..796 CDD:278443
Lustrin_cystein 1073..1114 CDD:291299
EB 1168..1219 CDD:279949
EB 1225..1276 CDD:279949
Lustrin_cystein 1445..1488 CDD:291299
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.