DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Y55F3BR.2

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001294458.1 Gene:Y55F3BR.2 / 190314 WormBaseID:WBGene00021939 Length:1549 Species:Caenorhabditis elegans


Alignment Length:121 Identity:32/121 - (26%)
Similarity:43/121 - (35%) Gaps:48/121 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FVFVAFVANALALKN-AICGL-------PHS---LNGDG-------------------------- 35
            |.|..|:.|....:| |.|.|       ||.   .||:|                          
 Worm   474 FTFNGFLGNFNNFQNQADCQLFCARLQCPHGSPLTNGNGSPQRCARDTDCPSTHTCAMEHQVCCP 538

  Fly    36 ----------RI-SCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
                      |: .|:..:..:.|:|:...|..|:|.||.||||||||...|:..|
 Worm   539 TPQTLCTEPLRVGDCKQSVRQFWYNAETKTCESFLYTGCQGNNNRFNSLNECQSYC 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 27/105 (26%)
Y55F3BR.2NP_001294458.1 EB 137..183 CDD:279949
KU <324..365 CDD:197529
KU <459..496 CDD:197529 8/21 (38%)
Kunitz_BPTI 544..595 CDD:278443 19/51 (37%)
KU 649..703 CDD:197529
KU 756..813 CDD:294074
EB 1190..1241 CDD:279949
EB 1246..1297 CDD:279949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.