DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and W05B2.2

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_499406.2 Gene:W05B2.2 / 189208 WormBaseID:WBGene00012271 Length:1278 Species:Caenorhabditis elegans


Alignment Length:56 Identity:19/56 - (33%)
Similarity:25/56 - (44%) Gaps:13/56 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            |||             :.:..|.||...|.|.:|.|.||.||:|.|.:|..|.:.|
 Worm   518 CGL-------------STLQRWYYDPLHNRCNQFEYQGCNGNDNNFVTRVDCIETC 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 18/54 (33%)
W05B2.2NP_499406.2 EB 67..118 CDD:460294
Kunitz_conkunitzin 191..247 CDD:438636
KU 305..355 CDD:197529
Kunitz_conkunitzin 508..560 CDD:438636 18/54 (33%)
KU 613..665 CDD:197529
Lustrin_cystein 719..764 CDD:464222
EB 1210..1262 CDD:460294
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.