DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and W05B2.2

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_499406.2 Gene:W05B2.2 / 189208 WormBaseID:WBGene00012271 Length:1278 Species:Caenorhabditis elegans


Alignment Length:56 Identity:19/56 - (33%)
Similarity:25/56 - (44%) Gaps:13/56 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            |||             :.:..|.||...|.|.:|.|.||.||:|.|.:|..|.:.|
 Worm   518 CGL-------------STLQRWYYDPLHNRCNQFEYQGCNGNDNNFVTRVDCIETC 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 19/56 (34%)
W05B2.2NP_499406.2 EB 67..118 CDD:279949
Kunitz_BPTI 190..248 CDD:278443
KU 305..355 CDD:197529
Kunitz_BPTI 507..560 CDD:278443 18/54 (33%)
KU 613..665 CDD:197529
EB 1210..1262 CDD:279949
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.