DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and K11D12.6

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_504350.1 Gene:K11D12.6 / 187293 WormBaseID:WBGene00019646 Length:186 Species:Caenorhabditis elegans


Alignment Length:81 Identity:30/81 - (37%)
Similarity:39/81 - (48%) Gaps:8/81 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGG 65
            |.||:|.|:|.|.|:      ..||..|..| |..:.|..:.| .:.||.....|:.|.|.||||
 Worm     1 MILLLLPFLFGASVS------QNICDSPVDL-GTAKCSNTSSI-RYHYDPTVKRCLPFGYTGCGG 57

  Fly    66 NNNRFNSREICEDKCL 81
            |.|.|....||..:|:
 Worm    58 NENNFADPRICRQRCI 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 21/55 (38%)
K11D12.6NP_504350.1 Kunitz_BPTI 18..72 CDD:425421 21/55 (38%)

Return to query results.
Submit another query.