DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and bli-5

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_499772.1 Gene:bli-5 / 185812 WormBaseID:WBGene00000255 Length:202 Species:Caenorhabditis elegans


Alignment Length:43 Identity:12/43 - (27%)
Similarity:23/43 - (53%) Gaps:3/43 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EAYIPSWSYDADRNECVKFIYG-GCGGNNNRFNSREICEDKCL 81
            :.|:..|.:|.:  :|::|.:. ....:.|.|.:|..|||.|:
 Worm   145 DGYLSRWGFDGE--QCIEFKWNPERPSSANNFKTRAHCEDYCI 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 11/41 (27%)
bli-5NP_499772.1 KU 134..184 CDD:294074 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.