DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and C54D10.10

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_506123.2 Gene:C54D10.10 / 183787 WormBaseID:WBGene00008304 Length:216 Species:Caenorhabditis elegans


Alignment Length:78 Identity:25/78 - (32%)
Similarity:39/78 - (50%) Gaps:7/78 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILVFVFVAFVANALALKNAICGLPHSLNGDGR-ISCEAYIPSWSYDADRNECVKFIYGGCGGNNN 68
            |.:|:.:..:::..|: |........:|.|.: |:.:.|     :|...|.|....|.|||||.|
 Worm     4 ISIFLLLCCISSVSAI-NCRQEKDTGVNCDNKPITLKFY-----FDMRTNVCQPLFYRGCGGNEN 62

  Fly    69 RFNSREICEDKCL 81
            ||.||:.|.|.|:
 Worm    63 RFESRDACSDACV 75

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 20/58 (34%)
C54D10.10NP_506123.2 Kunitz_BPTI 21..75 CDD:278443 20/58 (34%)
KU 158..214 CDD:238057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000145
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.