DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and C10G8.3

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_504417.2 Gene:C10G8.3 / 182502 WormBaseID:WBGene00015682 Length:190 Species:Caenorhabditis elegans


Alignment Length:81 Identity:24/81 - (29%)
Similarity:36/81 - (44%) Gaps:7/81 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILVFVFVAFVANALALKNAICGLPHSLNGDGRISCEAYIPSWS----YDADRNECVKFIYGGCGG 65
            ::..:|..::.:|.|.|..|.|..|.....|...|:   ..||    .|.....|:.|.|.|||.
 Worm     7 LISVIFAIYLNSAEAGKEHIAGACHDPFFLGDTPCD---KQWSIRYYMDVPTETCLAFNYTGCGH 68

  Fly    66 NNNRFNSREICEDKCL 81
            |.|.|.:.:.|.::||
 Worm    69 NWNNFATSQACYEECL 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 18/59 (31%)
C10G8.3NP_504417.2 KU 29..83 CDD:197529 16/56 (29%)

Return to query results.
Submit another query.