DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and C10G8.2

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_504418.1 Gene:C10G8.2 / 182501 WormBaseID:WBGene00015681 Length:208 Species:Caenorhabditis elegans


Alignment Length:35 Identity:11/35 - (31%)
Similarity:18/35 - (51%) Gaps:0/35 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 YDADRNECVKFIYGGCGGNNNRFNSREICEDKCLQ 82
            :|.....|:.|.:.||....|:|:|.:.|...||:
 Worm    46 FDQSTGLCMNFRWDGCKDQENKFDSLQECASTCLK 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 9/31 (29%)
C10G8.2NP_504418.1 Kunitz_BPTI <38..78 CDD:425421 9/31 (29%)

Return to query results.
Submit another query.