DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and B0222.5

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_505373.1 Gene:B0222.5 / 181860 WormBaseID:WBGene00015056 Length:369 Species:Caenorhabditis elegans


Alignment Length:36 Identity:12/36 - (33%)
Similarity:19/36 - (52%) Gaps:1/36 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCL 81
            | :|.:..:|..|.:.|||||.|.:.:...|...|:
 Worm   208 W-FDVETFQCFPFEHKGCGGNQNSYRTSSECYFDCV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 11/33 (33%)
B0222.5NP_505373.1 TY 22..84 CDD:238114
TY 87..154 CDD:238114
KU 186..241 CDD:197529 11/33 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.