DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and mlt-11

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001256938.1 Gene:mlt-11 / 180352 WormBaseID:WBGene00012186 Length:3129 Species:Caenorhabditis elegans


Alignment Length:57 Identity:22/57 - (38%)
Similarity:29/57 - (50%) Gaps:9/57 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DGRISCEA---------YIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCL 81
            |||:.|..         |.|.|.:::...:|.:|.||.||||.|.|..|..||.||:
 Worm  2172 DGRVVCAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKCM 2228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 20/54 (37%)
mlt-11NP_001256938.1 TY <361..409 CDD:238114
Kunitz-type 429..473 CDD:438633
Kunitz_BPTI 538..590 CDD:425421
Kunitz-type 737..787 CDD:438633
Kunitz_BPTI 803..855 CDD:425421
Kunitz_BPTI 865..917 CDD:425421
Kunitz-type 1083..1133 CDD:438633
Kunitz_BPTI 2176..2228 CDD:425421 18/51 (35%)
Kunitz_ixolaris_2 2241..2291 CDD:438669
Kunitz_BPTI 2742..2793 CDD:425421
Lustrin_cystein 2910..2956 CDD:464222
Kunitz_BPTI 3070..3128 CDD:425421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.