powered by:
Protein Alignment CG16713 and tag-290
DIOPT Version :9
Sequence 1: | NP_608799.1 |
Gene: | CG16713 / 33591 |
FlyBaseID: | FBgn0031560 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505945.1 |
Gene: | tag-290 / 179593 |
WormBaseID: | WBGene00009386 |
Length: | 219 |
Species: | Caenorhabditis elegans |
Alignment Length: | 36 |
Identity: | 16/36 - (44%) |
Similarity: | 22/36 - (61%) |
Gaps: | 0/36 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 45 SWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
|:.:|.....|..|:|.|||||.|||::.:.|.|.|
Worm 37 SFYFDTRMKVCQPFLYSGCGGNENRFSTSKECRDAC 72
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG16713 | NP_608799.1 |
KU |
23..81 |
CDD:238057 |
16/36 (44%) |
tag-290 | NP_505945.1 |
Kunitz_BPTI |
19..73 |
CDD:278443 |
16/36 (44%) |
KU |
156..211 |
CDD:197529 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.