DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and K10D3.4

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_492020.1 Gene:K10D3.4 / 172452 WormBaseID:WBGene00010738 Length:922 Species:Caenorhabditis elegans


Alignment Length:62 Identity:23/62 - (37%)
Similarity:32/62 - (51%) Gaps:5/62 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KNAICGLPHSLNGDGRISCEA-YIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCL 81
            ||.:|..|.    |..:.|.: .|..|.::||...|..|.|.||.||.|.|.|::.|::.||
 Worm   625 KNFVCSQPR----DVGVRCSSTRISRWYFNADSKTCQTFEYNGCEGNRNNFASQKSCQNYCL 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 19/56 (34%)
K10D3.4NP_492020.1 EB 46..100 CDD:460294
Kunitz_BPTI 170..226 CDD:425421
KU <312..352 CDD:197529
Kunitz_BPTI 410..462 CDD:425421
Kunitz_BPTI 518..571 CDD:425421
Kunitz_BPTI 628..681 CDD:425421 19/56 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.