DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and Aplp2

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001344627.1 Gene:Aplp2 / 11804 MGIID:88047 Length:763 Species:Mus musculus


Alignment Length:58 Identity:24/58 - (41%)
Similarity:33/58 - (56%) Gaps:5/58 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 AICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            |:|. ..::.|    .|.|.:|.|.:|..:.:||:|||||||||.|.|.|.:.|...|
Mouse   308 AVCS-QEAMTG----PCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYCMAVC 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 24/58 (41%)
Aplp2NP_001344627.1 A4_EXTRA 42..204 CDD:128326
Kunitz_BPTI 309..361 CDD:278443 23/57 (40%)
APP_E2 365..547 CDD:315580
APP_amyloid 709..759 CDD:313694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4295
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.