DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and WFIKKN1

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_444514.1 Gene:WFIKKN1 / 117166 HGNCID:30912 Length:548 Species:Homo sapiens


Alignment Length:56 Identity:25/56 - (44%)
Similarity:32/56 - (57%) Gaps:5/56 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            |.|| ::.|    .|..:.|.|:|.....:|..|:||||.||.|.|:|||.|||.|
Human   359 CVLP-AVQG----PCRGWEPRWAYSPLLQQCHPFVYGGCEGNGNNFHSRESCEDAC 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 25/56 (45%)
WFIKKN1NP_444514.1 WAP 29..76 CDD:306578
KAZAL_FS 120..155 CDD:238052
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..184
Ig_3 200..280 CDD:143242
KU 307..351 CDD:294074
Kunitz_BPTI 358..409 CDD:278443 24/54 (44%)
NTR_WFIKKN 427..537 CDD:239630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 51 1.000 Inparanoid score I5463
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.