powered by:
Protein Alignment CG16713 and SPINT3
DIOPT Version :9
Sequence 1: | NP_608799.1 |
Gene: | CG16713 / 33591 |
FlyBaseID: | FBgn0031560 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_006643.1 |
Gene: | SPINT3 / 10816 |
HGNCID: | 11248 |
Length: | 89 |
Species: | Homo sapiens |
Alignment Length: | 57 |
Identity: | 21/57 - (36%) |
Similarity: | 30/57 - (52%) |
Gaps: | 5/57 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 ICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
:|..|.. :..|:.|:..|.::.:..||..|.|||||||:|.|..:|.||..|
Human 35 VCAFPME-----KGPCQTYMTRWFFNFETGECELFAYGGCGGNSNNFLRKEKCEKFC 86
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG16713 | NP_608799.1 |
KU |
23..81 |
CDD:238057 |
21/57 (37%) |
SPINT3 | NP_006643.1 |
KU |
34..87 |
CDD:238057 |
21/57 (37%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4295 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.