DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and CG42713

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001188736.1 Gene:CG42713 / 10178890 FlyBaseID:FBgn0261630 Length:92 Species:Drosophila melanogaster


Alignment Length:90 Identity:24/90 - (26%)
Similarity:41/90 - (45%) Gaps:8/90 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLILVFVFVAFVANALAL--------KNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVK 57
            ||.|:::...|.:||.:.|.        :|.:.|....:......:.:.....|.|:...|.|:|
  Fly     1 MKFLLILASVVLYVALSSAQSCPGRPSHQNCLHGKDEGVERARHCNRDPNPQMWYYNQRENRCIK 65

  Fly    58 FIYGGCGGNNNRFNSREICEDKCLQ 82
            ..|.||.||.||:.:...|:.||::
  Fly    66 MRYLGCKGNRNRYCTLNECQRKCVR 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 14/55 (25%)
CG42713NP_001188736.1 Kunitz-type 31..88 CDD:438633 14/56 (25%)

Return to query results.
Submit another query.