DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and CG42716

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001189116.1 Gene:CG42716 / 10178784 FlyBaseID:FBgn0261633 Length:97 Species:Drosophila melanogaster


Alignment Length:94 Identity:31/94 - (32%)
Similarity:43/94 - (45%) Gaps:12/94 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLLILVFVF---VAFVANALALKNAI-CGLPHSLNGDGRI------SCEA-YIP-SWSYDADRN 53
            |..||::..|   :||..:.|..:..: .|.|.|.:|...|      .|.. ::| .|.|:....
  Fly     1 MNFLIILAFFTLNMAFANSQLRCRARMNSGGPRSCSGSRNIGTAFGLGCAMNFMPLVWYYNDKSR 65

  Fly    54 ECVKFIYGGCGGNNNRFNSREICEDKCLQ 82
            .|....|.|||||:|||.|.:.|...|||
  Fly    66 RCETMPYLGCGGNSNRFCSLQDCRFTCLQ 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 21/64 (33%)
CG42716NP_001189116.1 Kunitz-type <58..92 CDD:438633 14/33 (42%)

Return to query results.
Submit another query.