DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and EPPIN-WFDC6

DIOPT Version :10

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:NP_001185915.1 Gene:EPPIN-WFDC6 / 100526773 HGNCID:38825 Length:179 Species:Homo sapiens


Alignment Length:63 Identity:26/63 - (41%)
Similarity:31/63 - (49%) Gaps:5/63 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LALKNAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            |.||..:|.:|....     .|.||...|.||...|.|..|:||||.||||.|.|:..|.:.|
Human    70 LDLKQDVCEMPKETG-----PCLAYFLHWWYDKKDNTCSMFVYGGCQGNNNNFQSKANCLNTC 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 22/55 (40%)
EPPIN-WFDC6NP_001185915.1 Kunitz_eppin 75..131 CDD:438654 23/58 (40%)

Return to query results.
Submit another query.