DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16713 and wfikkn2

DIOPT Version :9

Sequence 1:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster
Sequence 2:XP_017953374.2 Gene:wfikkn2 / 100486381 XenbaseID:XB-GENE-922961 Length:559 Species:Xenopus tropicalis


Alignment Length:57 Identity:27/57 - (47%)
Similarity:36/57 - (63%) Gaps:5/57 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80
            :|..| :|.|    .|:||.|.|:|:....:|..|||||||||:|.|.::|.|||.|
 Frog   369 VCNFP-ALQG----MCKAYKPRWAYNKQLKQCQSFIYGGCGGNDNNFETKETCEDMC 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16713NP_608799.1 KU 23..81 CDD:238057 27/57 (47%)
wfikkn2XP_017953374.2 WAP 30..79 CDD:395047
KAZAL_FS 126..162 CDD:238052
IgI_3_WFIKKN-like 198..292 CDD:409422
Ig strand B 215..219 CDD:409422
Ig strand C 228..232 CDD:409422
Ig strand E 250..254 CDD:409422
Ig strand F 272..277 CDD:409422
Ig strand G 285..288 CDD:409422
KU 310..362 CDD:197529
Kunitz_BPTI 369..420 CDD:394972 26/55 (47%)
NTR_WFIKKN 438..546 CDD:239630
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9953
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5594
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.