powered by:
Protein Alignment CG16713 and LOC100485348
DIOPT Version :9
Sequence 1: | NP_608799.1 |
Gene: | CG16713 / 33591 |
FlyBaseID: | FBgn0031560 |
Length: | 82 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_031750923.1 |
Gene: | LOC100485348 / 100485348 |
-ID: | - |
Length: | 206 |
Species: | Xenopus tropicalis |
Alignment Length: | 60 |
Identity: | 25/60 - (41%) |
Similarity: | 32/60 - (53%) |
Gaps: | 5/60 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 NAICGLPHSLNGDGRISCEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKCL 81
:|:|.||.... .|.|.||.|.|:.:|..|..|:|.||.||.|||.::|.|...||
Frog 87 DAVCDLPMESG-----PCLALIPQWYYNKERGACHSFLYSGCQGNGNRFENKENCTTLCL 141
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG16713 | NP_608799.1 |
KU |
23..81 |
CDD:238057 |
23/57 (40%) |
LOC100485348 | XP_031750923.1 |
KU |
23..75 |
CDD:412162 |
|
KU |
88..141 |
CDD:238057 |
23/57 (40%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000145 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.